SCOPe 2.08: Domain d5nmdc1: 5nmd C:2-111

Lineage for d5nmdc1 (5nmd C:2-111)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5nmdc1: 5nmd C:2-111 [341588]
   Other proteins in same PDB: d5nmda2, d5nmdc2
   automated match to d2bnqd1
   complexed with edo, so4

Details for d5nmdc1

PDB Entry: 5nmd, 2.07 Å

PDB Description: 868 tcr specific for hla a02 presenting hiv epitope slyntvatl

PDB Compounds: (C:) Human T-cell receptor alpha chain

SCOPe Domain Sequences for d5nmdc1:

Sequence; same for both SEQRES and ATOM records:

>d5nmdc1 b.1.1.0 (C:2-111) automated matches {Human (Homo sapiens) [TaxId: 9606]}
keveqnsgplsvpegaiaslnctysdrgsqsffwyrqysgkspelimfiysngdkedgrf
taqlnkasqyisllirdsklsdsatylcavrtnsgyalnfgkgtsllvtp

Timeline for d5nmdc1:

• d5nmdc1 first appeared in SCOPe 2.06
  
• d5nmdc1 appears in SCOPe 2.07