SCOPe 2.08: Domain d5nmdd1: 5nmd D:1-113

Lineage for d5nmdd1 (5nmd D:1-113)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5nmdd1: 5nmd D:1-113 [341582]
   Other proteins in same PDB: d5nmda2, d5nmdc2
   automated match to d2axha1
   complexed with edo, so4

Details for d5nmdd1

PDB Entry: 5nmd, 2.07 Å

PDB Description: 868 tcr specific for hla a02 presenting hiv epitope slyntvatl

PDB Compounds: (D:) Human T-cell Receptor, beta chain

SCOPe Domain Sequences for d5nmdd1:

Sequence; same for both SEQRES and ATOM records:

>d5nmdd1 b.1.1.0 (D:1-113) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dagvtqspthliktrgqqvtlrcspkqghdtvswyqqalgqgpqfifqyyeeeerqrgnf
pdrfsghqfpnysselnvnalllgdsalylcassdtvsyeqyfgpgtrltvte

Timeline for d5nmdd1:

• d5nmdd1 first appeared in SCOPe 2.06
  
• d5nmdd1 appears in SCOPe 2.07