Lineage for d5nmdb1 (5nmd B:1-113)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2756326Domain d5nmdb1: 5nmd B:1-113 [341580]
    Other proteins in same PDB: d5nmda2, d5nmdc2
    automated match to d2axha1
    complexed with edo, so4

Details for d5nmdb1

PDB Entry: 5nmd (more details), 2.07 Å

PDB Description: 868 tcr specific for hla a02 presenting hiv epitope slyntvatl
PDB Compounds: (B:) Human T-cell Receptor, beta chain

SCOPe Domain Sequences for d5nmdb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nmdb1 b.1.1.0 (B:1-113) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dagvtqspthliktrgqqvtlrcspkqghdtvswyqqalgqgpqfifqyyeeeerqrgnf
pdrfsghqfpnysselnvnalllgdsalylcassdtvsyeqyfgpgtrltvte

SCOPe Domain Coordinates for d5nmdb1:

Click to download the PDB-style file with coordinates for d5nmdb1.
(The format of our PDB-style files is described here.)

Timeline for d5nmdb1: