Lineage for d1b0pb4 (1b0p B:416-668)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 839478Fold c.64: Pyruvate-ferredoxin oxidoreductase, PFOR, domain III [53322] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 231456; strand 3 is antiparallel to the rest
  4. 839479Superfamily c.64.1: Pyruvate-ferredoxin oxidoreductase, PFOR, domain III [53323] (1 family) (S)
  5. 839480Family c.64.1.1: Pyruvate-ferredoxin oxidoreductase, PFOR, domain III [53324] (1 protein)
  6. 839481Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domain III [53325] (1 species)
    also includes linker domain IV
  7. 839482Species Desulfovibrio africanus [TaxId:873] [53326] (10 PDB entries)
  8. 839498Domain d1b0pb4: 1b0p B:416-668 [34158]
    Other proteins in same PDB: d1b0pa1, d1b0pa2, d1b0pa3, d1b0pa5, d1b0pb1, d1b0pb2, d1b0pb3, d1b0pb5
    complexed with ca, fs4, mg, tpp

Details for d1b0pb4

PDB Entry: 1b0p (more details), 2.31 Å

PDB Description: crystal structure of pyruvate-ferredoxin oxidoreductase from desulfovibrio africanus
PDB Compounds: (B:) protein (pyruvate-ferredoxin oxidoreductase)

SCOP Domain Sequences for d1b0pb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b0pb4 c.64.1.1 (B:416-668) Pyruvate-ferredoxin oxidoreductase, PFOR, domain III {Desulfovibrio africanus [TaxId: 873]}
gtiqcqfwglgadgtvgankqaikiigdntdlfaqgyfsydskksggitishlrfgekpi
qstylvnradyvachnpayvgiydilegikdggtfvlnspwssledmdkhlpsgikrtia
nkklkfynidavkiatdvglggrinmimqtaffklagvlpfekavdllkksihkaygkkg
ekivkmntdavdqavtslqefkypdswkdapaetkaepmtneffknvvkpiltqqgdklp
vsafeadgrfplg

SCOP Domain Coordinates for d1b0pb4:

Click to download the PDB-style file with coordinates for d1b0pb4.
(The format of our PDB-style files is described here.)

Timeline for d1b0pb4: