SCOPe 2.08: Domain d5nhwl2: 5nhw L:113-216

Lineage for d5nhwl2 (5nhw L:113-216)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5nhwl2: 5nhw L:113-216 [341577]
   automated match to d4k3dl2
   complexed with gol

Details for d5nhwl2

PDB Entry: 5nhw, 1.78 Å

PDB Description: crystal structure of the bimagrumab fab

PDB Compounds: (L:) anti-human ActRII Bimagrumab Fab light-chain

SCOPe Domain Sequences for d5nhwl2:

Sequence; same for both SEQRES and ATOM records:

>d5nhwl2 b.1.1.0 (L:113-216) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvaptea

Timeline for d5nhwl2:

• d5nhwl2 first appeared in SCOPe 2.06
  
• d5nhwl2 appears in SCOPe 2.07