SCOPe 2.06: Domain d5nh3i1: 5nh3 I:1-113

Lineage for d5nh3i1 (5nh3 I:1-113)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d5nh3i1: 5nh3 I:1-113 [341572]
   Other proteins in same PDB: d5nh3a_, d5nh3b_, d5nh3h2, d5nh3i2, d5nh3l2, d5nh3m2
   automated match to d2d7th_
   complexed with nag

Details for d5nh3i1

PDB Entry: 5nh3, 2.35 Å

PDB Description: crystal structure of the activin receptor type-2a ligand binding domain in complex with bimagrumab fv

PDB Compounds: (I:) anti-human ActRIIB mAb BYM338 Fv heavy-chain

SCOPe Domain Sequences for d5nh3i1:

Sequence; same for both SEQRES and ATOM records:

>d5nh3i1 b.1.1.0 (I:1-113) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvqsgaevkkpgasvkvsckasgytftssyinwvrqapgqglewmgtinpvsgstsy
aqkfqgrvtmtrdtsistaymelsrlrsddtavyycarggwfdywgqgtlvtv

Timeline for d5nh3i1:

• d5nh3i1 is new in SCOPe 2.06-stable
  
• d5nh3i1 appears in SCOPe 2.07
  
• d5nh3i1 appears in the current release, SCOPe 2.08