| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein automated matches [190374] (15 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
| Domain d5nmda2: 5nmd A:112-201 [341566] Other proteins in same PDB: d5nmda1, d5nmdb1, d5nmdb2, d5nmdc1, d5nmdd1, d5nmdd2 automated match to d2bnqd2 complexed with edo, so4 |
PDB Entry: 5nmd (more details), 2.07 Å
SCOPe Domain Sequences for d5nmda2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5nmda2 b.1.1.2 (A:112-201) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hiqkpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksn
savawsnksdfacanafnnsiipedtffps
Timeline for d5nmda2: