Lineage for d5lwfd_ (5lwf D:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2023921Protein automated matches [190119] (22 species)
    not a true protein
  7. 2024425Species Llama (Lama glama) [TaxId:9844] [187485] (138 PDB entries)
  8. 2024666Domain d5lwfd_: 5lwf D: [341554]
    Other proteins in same PDB: d5lwfa_, d5lwfb_
    automated match to d5da4a_
    complexed with act

Details for d5lwfd_

PDB Entry: 5lwf (more details), 2.56 Å

PDB Description: structure of a single domain camelid antibody fragment cab-g10s in complex with the blap beta-lactamase from bacillus licheniformis
PDB Compounds: (D:) Camelid heavy-chain antibody variable fragment cAb-G10S

SCOPe Domain Sequences for d5lwfd_:

Sequence, based on SEQRES records: (download)

>d5lwfd_ b.1.1.1 (D:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qlqesggglvqaggslrlscaasgrtfsndhmgwfrkapgkerefvaaitpgtektyyad
svkgrfafsrdnakntvylqmnslkpedtavyycvatpyyrgsyyaastytywgqgtqvt
v

Sequence, based on observed residues (ATOM records): (download)

>d5lwfd_ b.1.1.1 (D:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qlqesgvqaggslrlscaasgrtfsndhmgwfrkapgkerefvaaitpgtektyyadsvk
grfafsrdnakntvylqmnslkpedtavyycvatpyyrgsyyaastytywgqgtqvtv

SCOPe Domain Coordinates for d5lwfd_:

Click to download the PDB-style file with coordinates for d5lwfd_.
(The format of our PDB-style files is described here.)

Timeline for d5lwfd_:

  • d5lwfd_ appears in periodic updates to SCOPe 2.06 starting on 2017-11-17
  • d5lwfd_ appears in the current release, SCOPe 2.07, called d5lwfd1