SCOPe 2.08: Domain d5lwfd1: 5lwf D:9-126

Lineage for d5lwfd1 (5lwf D:9-126)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)

8. Domain d5lwfd1: 5lwf D:9-126 [341554]
   Other proteins in same PDB: d5lwfa_, d5lwfb_, d5lwfc2, d5lwfd2
   automated match to d5da4a_
   complexed with act

Details for d5lwfd1

PDB Entry: 5lwf, 2.56 Å

PDB Description: structure of a single domain camelid antibody fragment cab-g10s in complex with the blap beta-lactamase from bacillus licheniformis

PDB Compounds: (D:) Camelid heavy-chain antibody variable fragment cAb-G10S

SCOPe Domain Sequences for d5lwfd1:

Sequence, based on SEQRES records:

>d5lwfd1 b.1.1.1 (D:9-126) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqaggslrlscaasgrtfsndhmgwfrkapgkerefvaaitpgtektyyadsvk
grfafsrdnakntvylqmnslkpedtavyycvatpyyrgsyyaastytywgqgtqvtv

Sequence, based on observed residues (ATOM records):

>d5lwfd1 b.1.1.1 (D:9-126) automated matches {Llama (Lama glama) [TaxId: 9844]}
esgvqaggslrlscaasgrtfsndhmgwfrkapgkerefvaaitpgtektyyadsvkgrf
afsrdnakntvylqmnslkpedtavyycvatpyyrgsyyaastytywgqgtqvtv

Timeline for d5lwfd1:

• d5lwfd1 first appeared in SCOPe 2.06, called d5lwfd_
  
• d5lwfd1 appears in SCOPe 2.07