Lineage for d5lwfd1 (5lwf D:9-126)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2743671Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)
  8. 2744079Domain d5lwfd1: 5lwf D:9-126 [341554]
    Other proteins in same PDB: d5lwfa_, d5lwfb_, d5lwfc2, d5lwfd2
    automated match to d5da4a_
    complexed with act

Details for d5lwfd1

PDB Entry: 5lwf (more details), 2.56 Å

PDB Description: structure of a single domain camelid antibody fragment cab-g10s in complex with the blap beta-lactamase from bacillus licheniformis
PDB Compounds: (D:) Camelid heavy-chain antibody variable fragment cAb-G10S

SCOPe Domain Sequences for d5lwfd1:

Sequence, based on SEQRES records: (download)

>d5lwfd1 b.1.1.1 (D:9-126) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqaggslrlscaasgrtfsndhmgwfrkapgkerefvaaitpgtektyyadsvk
grfafsrdnakntvylqmnslkpedtavyycvatpyyrgsyyaastytywgqgtqvtv

Sequence, based on observed residues (ATOM records): (download)

>d5lwfd1 b.1.1.1 (D:9-126) automated matches {Llama (Lama glama) [TaxId: 9844]}
esgvqaggslrlscaasgrtfsndhmgwfrkapgkerefvaaitpgtektyyadsvkgrf
afsrdnakntvylqmnslkpedtavyycvatpyyrgsyyaastytywgqgtqvtv

SCOPe Domain Coordinates for d5lwfd1:

Click to download the PDB-style file with coordinates for d5lwfd1.
(The format of our PDB-style files is described here.)

Timeline for d5lwfd1: