Lineage for d1poib_ (1poi B:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 595310Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 595311Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (6 families) (S)
  5. 595373Family c.124.1.3: CoA transferase beta subunit-like [74657] (2 proteins)
    catalytic subunit: similar active site structure to the NagB and RpiA families; mixed beta-sheet of 7 strands, order 4321567; strand 3 is antiparallel to the rest
  6. 595374Protein Glutaconate:CoA transferase beta [53320] (1 species)
  7. 595375Species Acidaminococcus fermentans [TaxId:905] [53321] (1 PDB entry)
  8. 595376Domain d1poib_: 1poi B: [34155]
    Other proteins in same PDB: d1poia_, d1poic_

Details for d1poib_

PDB Entry: 1poi (more details), 2.5 Å

PDB Description: crystal structure of glutaconate coenzyme a-transferase from acidaminococcus fermentans to 2.55 angstoms resolution

SCOP Domain Sequences for d1poib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1poib_ c.124.1.3 (B:) Glutaconate:CoA transferase beta {Acidaminococcus fermentans}
dytnytnkemqavtiakqikngqvvtvgtglpligasvakrvyapdchiivesglmdcsp
vevprsvgdlrfmahcgciwpnvrfvgfeineylhkanrliafiggaqidpygnvnstsi
gdyhhpktrftgsggangiatysntiimmqhekrrfmnkidyvtspgwidgpggrerlgl
pgdvgpqlvvtdkgilkfdektkrmylaayyptsspedvlentgfdldvskaveleapdp
aviklireeidpgqafiqvp

SCOP Domain Coordinates for d1poib_:

Click to download the PDB-style file with coordinates for d1poib_.
(The format of our PDB-style files is described here.)

Timeline for d1poib_: