Lineage for d1poic_ (1poi C:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 713168Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 713169Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (7 families) (S)
  5. 713200Family c.124.1.2: CoA transferase alpha subunit-like [74656] (6 proteins)
    parallel beta-sheet of 7 strands, order 4321567
  6. 713211Protein Glutaconate:CoA transferase alpha [53318] (1 species)
  7. 713212Species Acidaminococcus fermentans [TaxId:905] [53319] (1 PDB entry)
  8. 713214Domain d1poic_: 1poi C: [34154]
    Other proteins in same PDB: d1poib_, d1poid_
    complexed with cu

Details for d1poic_

PDB Entry: 1poi (more details), 2.5 Å

PDB Description: crystal structure of glutaconate coenzyme a-transferase from acidaminococcus fermentans to 2.55 angstoms resolution
PDB Compounds: (C:) glutaconate coenzyme a-transferase

SCOP Domain Sequences for d1poic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1poic_ c.124.1.2 (C:) Glutaconate:CoA transferase alpha {Acidaminococcus fermentans [TaxId: 905]}
skvmtlkdaiakyvhsgdhialggfttdrkpyaavfeilrqgitdltglggaaggdwdml
igngrvkayincytansgvtnvsrrfrkwfeagkltmedysqdviymmwhaaalglpflp
vtlmqgsgltdewgiskevrktldkvpddkfkyidnpfkpgekvvavpvpqvdvaiihaq
qaspdgtvriwggkfqdvdiaeaakytivtceeiisdeeirrdptkndipgmcvdavvla
pygahpsqcyglydydnpflkvydkvsktqedfdafckewvfdlkdhdeylnklgatrli
nlkvvpglgyhidmtke

SCOP Domain Coordinates for d1poic_:

Click to download the PDB-style file with coordinates for d1poic_.
(The format of our PDB-style files is described here.)

Timeline for d1poic_: