![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
![]() | Superfamily d.129.3: Bet v1-like [55961] (11 families) ![]() contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
![]() | Family d.129.3.0: automated matches [191339] (1 protein) not a true family |
![]() | Protein automated matches [190218] (22 species) not a true protein |
![]() | Species Hypericum perforatum [TaxId:65561] [189103] (2 PDB entries) |
![]() | Domain d4n3es_: 4n3e S: [341537] automated match to d1e09a_ complexed with 2an, epe, so4 |
PDB Entry: 4n3e (more details), 2.43 Å
SCOPe Domain Sequences for d4n3es_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4n3es_ d.129.3.0 (S:) automated matches {Hypericum perforatum [TaxId: 65561]} maaytivkeeespiaphrlfkalvlerhqvlvkaqphvfksgeiiegdggvgtvtkitfv dghpltymlhkfdeidaanfyckytlfegdvlrdniekvvyevkleavgggskgkitvty hpkpgctvneeevkigekkayefykqveeylaanpevfa
Timeline for d4n3es_: