Lineage for d4moub_ (4mou B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2435650Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2435651Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2436644Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2436645Protein automated matches [190246] (60 species)
    not a true protein
  7. 2436660Species Arthrobacter aurescens [TaxId:290340] [341532] (1 PDB entry)
  8. 2436662Domain d4moub_: 4mou B: [341533]
    automated match to d1ef8a_
    complexed with cac

Details for d4moub_

PDB Entry: 4mou (more details), 2.25 Å

PDB Description: crystal structure of an enoyl-coa hydratase/isomerase family member, nysgrc target 028282
PDB Compounds: (B:) Enoyl-CoA hydratase/isomerase family protein

SCOPe Domain Sequences for d4moub_:

Sequence, based on SEQRES records: (download)

>d4moub_ c.14.1.0 (B:) automated matches {Arthrobacter aurescens [TaxId: 290340]}
arprtgrisvaiadgvasveisnlaqrnaltkdmcleiqelmpqldadpdvavvvlrgag
dtfcagasiselasvlldpqpdgstadhlsradsaiaalskpavalvdgacmgggwqias
acdfiianeravigltpakigiiyprpglerlvrlvghanakyilltgqtfsapearalg
lvadvvpsesfeekcaalvrslrsrsrfsmhsmkrlvdltdsvpaagidqewaaawsamp
dspdmgigisaflnreqprfmwrpa

Sequence, based on observed residues (ATOM records): (download)

>d4moub_ c.14.1.0 (B:) automated matches {Arthrobacter aurescens [TaxId: 290340]}
arprtgrisvaiadgvasveisnlaqrnaltkdmcleiqelmpqldadpdvavvvlrgag
dtfcagasiselasvlldpqpdgstadhlsradsaiaalskpavalvdgacmgggwqias
acdfiianeravigltpakigiiyprpglerlvrlvghanakyilltgqtfsapearalg
lvadvvpsesfeekcaalvrslrsrsrfsmhsmkrlvdltdsgidqewaaawsampdspd
mgigisaflnreqprfmwrpa

SCOPe Domain Coordinates for d4moub_:

Click to download the PDB-style file with coordinates for d4moub_.
(The format of our PDB-style files is described here.)

Timeline for d4moub_: