Class a: All alpha proteins [46456] (290 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins) oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus binds a bilin chromophore automatically mapped to Pfam PF00502 |
Protein Phycocyanin alpha subunit [88933] (10 species) |
Species Thermosynechococcus elongatus [TaxId:197221] [189582] (12 PDB entries) |
Domain d5mjpa_: 5mjp A: [341531] Other proteins in same PDB: d5mjpb_ automated match to d1jboa_ complexed with cyc |
PDB Entry: 5mjp (more details), 2.11 Å
SCOPe Domain Sequences for d5mjpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5mjpa_ a.1.1.3 (A:) Phycocyanin alpha subunit {Thermosynechococcus elongatus [TaxId: 197221]} mktpiteaiaaadtqgrflsntelqavdgrfkravasmeaaraltnnaqslidgaaqavy qkfpytttmqgsqyastpegkakcardigyylrmvtyclvaggtgpmdeyliaglseins tfdlspswyiealkyikanhgltgqaaveanayidyainals
Timeline for d5mjpa_: