Lineage for d5mjqb_ (5mjq B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2302308Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 2302416Protein Phycocyanin beta subunit [88940] (9 species)
  7. 2302465Species Thermosynechococcus elongatus [TaxId:197221] [189583] (11 PDB entries)
  8. 2302475Domain d5mjqb_: 5mjq B: [341529]
    Other proteins in same PDB: d5mjqa_
    automated match to d1ktpb_
    complexed with cyc

Details for d5mjqb_

PDB Entry: 5mjq (more details), 2.7 Å

PDB Description: single-shot pink beam serial crystallography: phycocyanin (one chip)
PDB Compounds: (B:) C-phycocyanin beta chain

SCOPe Domain Sequences for d5mjqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mjqb_ a.1.1.3 (B:) Phycocyanin beta subunit {Thermosynechococcus elongatus [TaxId: 197221]}
mldafakvvaqadargefltnaqfdalsnlvkegnkrldavnritsnastivanaaralf
aeqpqliqpggnaytnrrmaaclrdmeiilryvtyailagdssvlddrclnglretyqal
gtpgssvavaiqkmkdaaiaiandpngitpgdcsalmseiagyfdraaaava

SCOPe Domain Coordinates for d5mjqb_:

Click to download the PDB-style file with coordinates for d5mjqb_.
(The format of our PDB-style files is described here.)

Timeline for d5mjqb_: