| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein automated matches [190374] (15 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
| Domain d5m76b2: 5m76 B:111-212 [341525] Other proteins in same PDB: d5m76a1, d5m76b1 automated match to d1aqkl2 complexed with br |
PDB Entry: 5m76 (more details), 2.5 Å
SCOPe Domain Sequences for d5m76b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5m76b2 b.1.1.2 (B:111-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapt
Timeline for d5m76b2: