Lineage for d5m6ib2 (5m6i B:112-213)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2751062Domain d5m6ib2: 5m6i B:112-213 [341522]
    Other proteins in same PDB: d5m6ia1, d5m6ib1
    automated match to d2fb4l2
    complexed with na

Details for d5m6ib2

PDB Entry: 5m6i (more details), 2.2 Å

PDB Description: crystal structure of non-cardiotoxic bence-jones light chain dimer m8
PDB Compounds: (B:) light chain dimer

SCOPe Domain Sequences for d5m6ib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m6ib2 b.1.1.2 (B:112-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkanptvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapt

SCOPe Domain Coordinates for d5m6ib2:

Click to download the PDB-style file with coordinates for d5m6ib2.
(The format of our PDB-style files is described here.)

Timeline for d5m6ib2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5m6ib1