![]() | Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
![]() | Fold c.62: vWA-like [53299] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
![]() | Superfamily c.62.1: vWA-like [53300] (4 families) ![]() |
![]() | Family c.62.1.1: Integrin A (or I) domain [53301] (10 proteins) |
![]() | Protein Integrin alpha2-beta1 [53313] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [53314] (3 PDB entries) |
![]() | Domain d1aoxb_: 1aox B: [34152] complexed with mg; mutant |
PDB Entry: 1aox (more details), 2.1 Å
SCOP Domain Sequences for d1aoxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aoxb_ c.62.1.1 (B:) Integrin alpha2-beta1 {Human (Homo sapiens)} rsscpslidvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqyannprvvfn lntyktkeemivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdge shdgsmlkavidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvs deaallekagtlgeqifsieg
Timeline for d1aoxb_: