Lineage for d5lwfc1 (5lwf C:9-126)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2347168Protein automated matches [190119] (20 species)
    not a true protein
  7. 2347651Species Llama (Lama glama) [TaxId:9844] [187485] (149 PDB entries)
  8. 2347879Domain d5lwfc1: 5lwf C:9-126 [341507]
    Other proteins in same PDB: d5lwfa_, d5lwfb_, d5lwfc2, d5lwfd2
    automated match to d5da4a_
    complexed with act

Details for d5lwfc1

PDB Entry: 5lwf (more details), 2.56 Å

PDB Description: structure of a single domain camelid antibody fragment cab-g10s in complex with the blap beta-lactamase from bacillus licheniformis
PDB Compounds: (C:) Camelid heavy-chain antibody variable fragment cAb-G10S

SCOPe Domain Sequences for d5lwfc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lwfc1 b.1.1.1 (C:9-126) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqaggslrlscaasgrtfsndhmgwfrkapgkerefvaaitpgtektyyadsvk
grfafsrdnakntvylqmnslkpedtavyycvatpyyrgsyyaastytywgqgtqvtv

SCOPe Domain Coordinates for d5lwfc1:

Click to download the PDB-style file with coordinates for d5lwfc1.
(The format of our PDB-style files is described here.)

Timeline for d5lwfc1:

  • d5lwfc1 first appeared in SCOPe 2.06, called d5lwfc_