Lineage for d1ck4b_ (1ck4 B:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 318167Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 318168Superfamily c.62.1: vWA-like [53300] (2 families) (S)
  5. 318169Family c.62.1.1: Integrin A (or I) domain [53301] (8 proteins)
  6. 318187Protein Integrin alpha1-beta1 [53310] (2 species)
  7. 318191Species Rat (Rattus norvegicus) [TaxId:10116] [53312] (2 PDB entries)
  8. 318193Domain d1ck4b_: 1ck4 B: [34150]

Details for d1ck4b_

PDB Entry: 1ck4 (more details), 2.2 Å

PDB Description: crystal structure of rat a1b1 integrin i-domain.

SCOP Domain Sequences for d1ck4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ck4b_ c.62.1.1 (B:) Integrin alpha1-beta1 {Rat (Rattus norvegicus)}
tqldivivldgsnsiypwesviaflndllkrmdigpkqtqvgivqygenvthefnlnkys
steevlvaankigrqgglqtmtalgidtarkeafteargarrgvkkvmvivtdgeshdny
rlkqviqdcedeniqrfsiailghynrgnlstekfveeiksiaseptekhffnvsdelal
vtivkalgerifale

SCOP Domain Coordinates for d1ck4b_:

Click to download the PDB-style file with coordinates for d1ck4b_.
(The format of our PDB-style files is described here.)

Timeline for d1ck4b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ck4a_