Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (239 species) not a true protein |
Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [226760] (20 PDB entries) |
Domain d5k50e_: 5k50 E: [341483] automated match to d4yrab_ complexed with act, alo, gol, nad |
PDB Entry: 5k50 (more details), 2.26 Å
SCOPe Domain Sequences for d5k50e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5k50e_ c.2.1.0 (E:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]} prvlvtgalgqigtdlslalrdkfgadsvlvsdvvepgakhplaglkgvekldcldsngf eklvkefkptwmyhlpaimsvrgeaepdlamdinvnttryalelarkynirifipstiaa fgdkcgktmtkddtimnpstvygvtkvytellgtwyrqkygvdfrsvrlpgiisaatlpg ggatdyaihmyhsallqkkcvcpvlpyeslpmmympdtlnslvkimeaplekltrtvyni tgfsfspselrfsierctdrtieveyvegpaqkianswpdslddsnarndwghqvkydid mmsedmlrqipilhglpsl
Timeline for d5k50e_: