Lineage for d4efca_ (4efc A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2337216Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 2337217Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. 2337388Family a.127.1.0: automated matches [191431] (1 protein)
    not a true family
  6. 2337389Protein automated matches [190621] (25 species)
    not a true protein
  7. 2337558Species Trypanosoma brucei [TaxId:999953] [341449] (1 PDB entry)
  8. 2337559Domain d4efca_: 4efc A: [341451]
    automated match to d3bhga_
    complexed with amp, edo, mg, na

Details for d4efca_

PDB Entry: 4efc (more details), 2 Å

PDB Description: crystal structure of adenylosuccinate lyase from trypanosoma brucei, tb427tmp.160.5560
PDB Compounds: (A:) adenylosuccinate lyase

SCOPe Domain Sequences for d4efca_:

Sequence, based on SEQRES records: (download)

>d4efca_ a.127.1.0 (A:) automated matches {Trypanosoma brucei [TaxId: 999953]}
vdysvdnplfalspldgrykrqtkalraffseygffryrvlveveyftalckdvptivpl
rsvtdeqlqklrkitldcfsvssaeeikrlervtnhdikaveyfikermdtcglshvtef
vhfgltsqdinntaipmmirdaivtlylpaldgiigsltsklvdwdvpmlarthgqpasp
tnlakefvvwierlreqrrqlcevpttgkfggatgnfnahlvaypsvnwrafadmflaky
lglkrqqattqienydhlaalcdacarlhvilidmcrdvwqyismgffkqkvkegevgss
tmphkvnpidfenaegnlalsnallnffasklpisrlqrdltdstvlrnlgvpighacva
fasisqgleklmisretisrelssnwavvaegiqtvlrrecypkpyetlkkltqgntdvt
eeqvrnfingltdisddvraellaitpftyvgyvprf

Sequence, based on observed residues (ATOM records): (download)

>d4efca_ a.127.1.0 (A:) automated matches {Trypanosoma brucei [TaxId: 999953]}
vdysvdnplfalspldgrykrqtkalraffseygffryrvlveveyftalckdvptivpl
rsvtdeqlqklrkitldcfsvssaeeikrlervtnhdikaveyfikermdtcglshvtef
vhfgltsqdinntaipmmirdaivtlylpaldgiigsltsklvdwdvpmlarthgqpasp
tnlakefvvwierlreqrrqlcevpttgkfggatgnfnahlvaypsvnwrafadmflaky
lglkrqqattqienydhlaalcdacarlhvilidmcrdvwqyismgffkqkvkegevgss
tmphkvnpidfenaegnlalsnallnffasklpisrlqrdltdstvlrnlgvpighacva
fasisqgleklmisretisrelssnwavvaegiqtvlrrecypkpyetlkkltvteeqvr
nfingltdisddvraellaitpftyvgyvprf

SCOPe Domain Coordinates for d4efca_:

Click to download the PDB-style file with coordinates for d4efca_.
(The format of our PDB-style files is described here.)

Timeline for d4efca_: