Lineage for d5l8r4_ (5l8r 4:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2256154Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily)
    membrane all-alpha fold; three transmembrane helices
  4. 2256155Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (2 families) (S)
    duplication: contains two structural repeats
  5. 2256178Family f.43.1.0: automated matches [276197] (1 protein)
    not a true family
  6. 2256179Protein automated matches [276200] (2 species)
    not a true protein
  7. 2256180Species Pea (Pisum sativum) [TaxId:3888] [276203] (4 PDB entries)
  8. 2256184Domain d5l8r4_: 5l8r 4: [341442]
    Other proteins in same PDB: d5l8ra_, d5l8rb_, d5l8rc_, d5l8rd_, d5l8re1, d5l8re2, d5l8rf_, d5l8rj_
    automated match to d4y284_
    complexed with bcr, ca, chl, cl0, cla, dgd, lhg, lmg, lmt, lut, pqn, sf4, xat, zex

Details for d5l8r4_

PDB Entry: 5l8r (more details), 2.6 Å

PDB Description: the structure of plant photosystem i super-complex at 2.6 angstrom resolution.
PDB Compounds: (4:) chlorophyll a-b binding protein p4, chloroplastic

SCOPe Domain Sequences for d5l8r4_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l8r4_ f.43.1.0 (4:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
kkgewlpglaspgyltgslpgdngfdplglaedpenlkwfvqaelvngrwamlgvagmll
pevftsigiinvpkwydagkeeyfassstlfviefilfhyveirrwqdiknpgsvnqdpi
fkqyslpagevgypggifnplnfaptleakekeiangrlamlaflgfiiqhnvtgkgpfd
nllqhisdpwhntivqtl

SCOPe Domain Coordinates for d5l8r4_:

Click to download the PDB-style file with coordinates for d5l8r4_.
(The format of our PDB-style files is described here.)

Timeline for d5l8r4_: