SCOPe 2.06: Domain d5vmjb_: 5vmj B:

Lineage for d5vmjb_ (5vmj B:)

1. Root: SCOPe 2.06

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.0: automated matches [254278] (1 protein)
   not a true family

6. Protein automated matches [254645] (23 species)
   not a true protein

7. Species Influenza a virus (strain a/brevig mission/1/1918 h1n1) [TaxId:88776] [341366] (4 PDB entries)

8. Domain d5vmjb_: 5vmj B: [341435]
   Other proteins in same PDB: d5vmja_, d5vmjc_, d5vmje_
   automated match to d5bnyf_
   complexed with bma, gal, nag, sia; mutant

Details for d5vmjb_

PDB Entry: 5vmj, 2.95 Å

PDB Description: influenza hemagglutinin h1 mutant dh1e in complex with 3'sln

PDB Compounds: (B:) hemagglutinin HA2

SCOPe Domain Sequences for d5vmjb_:

Sequence; same for both SEQRES and ATOM records:

>d5vmjb_ h.3.1.0 (B:) automated matches {Influenza a virus (strain a/brevig mission/1/1918 h1n1) [TaxId: 88776]}
glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsviekmn
tqftavgkefnnlerrienlnkkvddgfldiwtynaellvllenertldfhdsnvrnlye
kvksqlknnakeigngcfefyhkcddacmesvrngtydypkyse

Timeline for d5vmjb_:

• d5vmjb_ is new in SCOPe 2.06-stable
  
• d5vmjb_ appears in SCOPe 2.07
  
• d5vmjb_ appears in the current release, SCOPe 2.08