SCOPe 2.06: Domain d5xc7a1: 5xc7 A:172-482

Lineage for d5xc7a1 (5xc7 A:172-482)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.14: RNA helicase [52724] (4 proteins)
   duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension

6. Protein automated matches [226986] (8 species)
   not a true protein

7. Species Dengue virus 4 [TaxId:11070] [341427] (1 PDB entry)

8. Domain d5xc7a1: 5xc7 A:172-482 [341428]
   Other proteins in same PDB: d5xc7a2, d5xc7a3
   automated match to d2jlua1
   complexed with cl, gol; mutant

Details for d5xc7a1

PDB Entry: 5xc7, 2.1 Å

PDB Description: dengue virus 4 ns3 helicase d290a mutant

PDB Compounds: (A:) NS3 helicase

SCOPe Domain Sequences for d5xc7a1:

Sequence; same for both SEQRES and ATOM records:

>d5xc7a1 c.37.1.14 (A:172-482) automated matches {Dengue virus 4 [TaxId: 11070]}
gepdyevdedifrkkrltimdlhpgagktkrilpsivrealkrrlrtlilaptrvvaaem
eealrglpiryqtpavksdhtgreivdlmchatfttrllsstrvpnynlivmdeahftap
csvaargyistrvemgeaaaifmtatppgsidpfpqsnspiediereiperswntgfdwi
tdyqgktvwfvpsikagndianclrksgkrviqlsrktfdteypktkltdwdfvvttdis
emganfragrvidprrclkpviltdgpervilagpipvtpasaaqrrgrigrnpaqeddq
yvfsgdplknd

Timeline for d5xc7a1:

• d5xc7a1 is new in SCOPe 2.06-stable
  
• d5xc7a1 appears in SCOPe 2.07
  
• d5xc7a1 appears in the current release, SCOPe 2.08