Lineage for d5xv8b1 (5xv8 B:2-108)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2394380Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2394381Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2394913Family b.55.1.9: TFIIH domain [110272] (2 proteins)
  6. 2394927Protein TFIIH basal transcription factor complex p62 subunit (BTF2-p62), N-terminal domain [110273] (1 species)
  7. 2394928Species Human (Homo sapiens) [TaxId:9606] [110274] (5 PDB entries)
    Uniprot P32780 1-108
  8. 2394930Domain d5xv8b1: 5xv8 B:2-108 [341424]
    Other proteins in same PDB: d5xv8b2
    automated match to d2rukb_
    protein/DNA complex

Details for d5xv8b1

PDB Entry: 5xv8 (more details)

PDB Description: solution structure of the complex between uvssa acidic region and tfiih p62 ph domain
PDB Compounds: (B:) General transcription factor IIH subunit 1

SCOPe Domain Sequences for d5xv8b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xv8b1 b.55.1.9 (B:2-108) TFIIH basal transcription factor complex p62 subunit (BTF2-p62), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
atsseevllivkkvrqkkqdgalylmaeriawapegkdrftishmyadikcqkispegka
kiqlqlvlhagdttnfhfsnestavkerdavkdllqqllpkfkrkan

SCOPe Domain Coordinates for d5xv8b1:

Click to download the PDB-style file with coordinates for d5xv8b1.
(The format of our PDB-style files is described here.)

Timeline for d5xv8b1: