SCOPe 2.08: Domain d5vkia_: 5vki A:

Lineage for d5vkia_ (5vki A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (70 species)
   not a true protein

7. Species Human rotavirus a [TaxId:10941] [187643] (15 PDB entries)

8. Domain d5vkia_: 5vki A: [341423]
   automated match to d2dwra_
   complexed with gol, so4, thr

Details for d5vkia_

PDB Entry: 5vki, 1.9 Å

PDB Description: crystal structure of p[19] rotavirus vp8* complexed with mucin core 2

PDB Compounds: (A:) Outer capsid protein VP4

SCOPe Domain Sequences for d5vkia_:

Sequence; same for both SEQRES and ATOM records:

>d5vkia_ b.29.1.0 (A:) automated matches {Human rotavirus a [TaxId: 10941]}
vldgpyqpvtfkppndywilinsnsngvvlegtnntdvwvaiisiepnvnsesrqyslfg
vnkqitvvntsnkwkfmemfrnnsnaefqhkrtltsstklvgilkhggrlwtyhgetpna
ttdysttsnlneisvttyaefyiiprsqeskcteyintgl

Timeline for d5vkia_:

• d5vkia_ first appeared in SCOPe 2.06
  
• d5vkia_ appears in SCOPe 2.07