Class b: All beta proteins [48724] (177 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
Protein automated matches [190291] (25 species) not a true protein |
Species Influenza a virus (a/new_york/1/18(h1n1)) [TaxId:88775] [341368] (2 PDB entries) |
Domain d5vmje_: 5vmj E: [341420] Other proteins in same PDB: d5vmjb_, d5vmjd_, d5vmjf_ automated match to d3ztna_ complexed with bma, gal, nag, sia; mutant |
PDB Entry: 5vmj (more details), 2.95 Å
SCOPe Domain Sequences for d5vmje_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vmje_ b.19.1.2 (E:) automated matches {Influenza a virus (a/new_york/1/18(h1n1)) [TaxId: 88775]} dticigyhannstdtvdtvleknvtvthsvnlledshngklcklkgiaplqlgkcniagw llgnpecdllltasswsyivetsnsengtcypgdfidyeelreqlssvssfekfeifpkt sswpnhettgvtaacsyagassfyrnllwltkkgssypklsksyvnnkgkevlvlwgvhh pptgteqqslyqnadayvsvgsskynrrftpeiaarpkvrglasrmnyywtllepgdtit featgnliapwyafalnrgsgsgiitsdapvhdcntkcqtphgainsslpfqnihpvtig ecpkyvrstklrmatglrnip
Timeline for d5vmje_: