Lineage for d5vmje_ (5vmj E:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2047495Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2047496Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2047543Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2047955Protein automated matches [190291] (25 species)
    not a true protein
  7. 2048001Species Influenza a virus (a/new_york/1/18(h1n1)) [TaxId:88775] [341368] (2 PDB entries)
  8. 2048007Domain d5vmje_: 5vmj E: [341420]
    Other proteins in same PDB: d5vmjb_, d5vmjd_, d5vmjf_
    automated match to d3ztna_
    complexed with bma, gal, nag, sia; mutant

Details for d5vmje_

PDB Entry: 5vmj (more details), 2.95 Å

PDB Description: influenza hemagglutinin h1 mutant dh1e in complex with 3'sln
PDB Compounds: (E:) hemagglutinin HA1

SCOPe Domain Sequences for d5vmje_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vmje_ b.19.1.2 (E:) automated matches {Influenza a virus (a/new_york/1/18(h1n1)) [TaxId: 88775]}
dticigyhannstdtvdtvleknvtvthsvnlledshngklcklkgiaplqlgkcniagw
llgnpecdllltasswsyivetsnsengtcypgdfidyeelreqlssvssfekfeifpkt
sswpnhettgvtaacsyagassfyrnllwltkkgssypklsksyvnnkgkevlvlwgvhh
pptgteqqslyqnadayvsvgsskynrrftpeiaarpkvrglasrmnyywtllepgdtit
featgnliapwyafalnrgsgsgiitsdapvhdcntkcqtphgainsslpfqnihpvtig
ecpkyvrstklrmatglrnip

SCOPe Domain Coordinates for d5vmje_:

Click to download the PDB-style file with coordinates for d5vmje_.
(The format of our PDB-style files is described here.)

Timeline for d5vmje_: