Lineage for d5yola_ (5yol A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2194362Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2194897Family d.58.6.0: automated matches [191597] (1 protein)
    not a true family
  6. 2194898Protein automated matches [191087] (14 species)
    not a true protein
  7. 2194899Species Acinetobacter baumannii [TaxId:470] [341391] (1 PDB entry)
  8. 2194900Domain d5yola_: 5yol A: [341408]
    automated match to d4uoha_
    complexed with mg

Details for d5yola_

PDB Entry: 5yol (more details), 2.2 Å

PDB Description: crystal structure of octameric form of nucleoside diphosphate kinase from acinetobacter baumannii at 2.2 a resolution
PDB Compounds: (A:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d5yola_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yola_ d.58.6.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 470]}
maiertlsivkpdavsknhigeifarfekaglkivatkmkhlsqadaegfyaehkergff
gdlvafmtsgpvvvsvlegenavlahreilgatnpkeaapgtiradfavsidenaahgsd
svasaereiayffadneicprtr

SCOPe Domain Coordinates for d5yola_:

Click to download the PDB-style file with coordinates for d5yola_.
(The format of our PDB-style files is described here.)

Timeline for d5yola_: