| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) ![]() |
| Family d.58.6.0: automated matches [191597] (1 protein) not a true family |
| Protein automated matches [191087] (19 species) not a true protein |
| Species Acinetobacter baumannii [TaxId:470] [341391] (1 PDB entry) |
| Domain d5yole_: 5yol E: [341405] automated match to d4uoha_ complexed with mg |
PDB Entry: 5yol (more details), 2.2 Å
SCOPe Domain Sequences for d5yole_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5yole_ d.58.6.0 (E:) automated matches {Acinetobacter baumannii [TaxId: 470]}
maiertlsivkpdavsknhigeifarfekaglkivatkmkhlsqadaegfyaehkergff
gdlvafmtsgpvvvsvlegenavlahreilgatnpkeaapgtiradfavsidenaahgsd
svasaereiayffadneicprtr
Timeline for d5yole_: