Lineage for d5o96g1 (5o96 G:3-75)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2411564Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 2411565Superfamily b.122.1: PUA domain-like [88697] (14 families) (S)
  5. 2411823Family b.122.1.0: automated matches [191599] (1 protein)
    not a true family
  6. 2411824Protein automated matches [191089] (7 species)
    not a true protein
  7. 2411835Species Legionella pneumophila [TaxId:446] [341248] (2 PDB entries)
  8. 2411846Domain d5o96g1: 5o96 G:3-75 [341403]
    Other proteins in same PDB: d5o96a2, d5o96b2, d5o96c2, d5o96d2, d5o96e2, d5o96f2, d5o96g2, d5o96h2
    automated match to d4e8ba1
    protein/RNA complex; complexed with sam

Details for d5o96g1

PDB Entry: 5o96 (more details), 2.3 Å

PDB Description: structure of the putative methyltransferase lpg2936 from legionella pneumophila in complex with the bound cofactor sam
PDB Compounds: (G:) Ribosomal RNA small subunit methyltransferase E

SCOPe Domain Sequences for d5o96g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5o96g1 b.122.1.0 (G:3-75) automated matches {Legionella pneumophila [TaxId: 446]}
vrtiriyqpgeyqpgqllelspeagqhvgvvlrmeqgeqltlfngdnkeftasiervkkk
qvfvriasvlevn

SCOPe Domain Coordinates for d5o96g1:

Click to download the PDB-style file with coordinates for d5o96g1.
(The format of our PDB-style files is described here.)

Timeline for d5o96g1: