Lineage for d5x8hc_ (5x8h C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2454167Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2454168Protein automated matches [190069] (309 species)
    not a true protein
  7. 2454898Species Chryseobacterium sp. [TaxId:1345601] [341394] (2 PDB entries)
  8. 2454905Domain d5x8hc_: 5x8h C: [341397]
    automated match to d4rlhb_

Details for d5x8hc_

PDB Entry: 5x8h (more details), 1.85 Å

PDB Description: crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. ca49
PDB Compounds: (C:) Short-chain dehydrogenase reductase

SCOPe Domain Sequences for d5x8hc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5x8hc_ c.2.1.0 (C:) automated matches {Chryseobacterium sp. [TaxId: 1345601]}
gildnkvalvtgagsgiglavahsyakegakvivsdinedhgnkavedikaqggeasfvk
adtsnpeevealvkrtveiygrldiacnnagiggeqalagdygldswrkvlsinldgvfy
gckyeleqmekngggvivnmasihgivaaplssaytsakhavvgltknigaeygqknirc
navgpayietpllesltkemkealiskhpmgrlgkpeevaelvlflssekssfmtggyyl
vdggytav

SCOPe Domain Coordinates for d5x8hc_:

Click to download the PDB-style file with coordinates for d5x8hc_.
(The format of our PDB-style files is described here.)

Timeline for d5x8hc_: