Lineage for d1ido__ (1ido -)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 399192Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 399193Superfamily c.62.1: vWA-like [53300] (4 families) (S)
  5. 399194Family c.62.1.1: Integrin A (or I) domain [53301] (10 proteins)
  6. 399202Protein Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha subunit) [53308] (1 species)
  7. 399203Species Human (Homo sapiens) [TaxId:9606] [53309] (9 PDB entries)
  8. 399206Domain d1ido__: 1ido - [34139]
    complexed with mg

Details for d1ido__

PDB Entry: 1ido (more details), 1.7 Å

PDB Description: i-domain from integrin cr3, mg2+ bound

SCOP Domain Sequences for d1ido__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ido__ c.62.1.1 (-) Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha subunit) {Human (Homo sapiens)}
dsdiaflidgsgsiiphdfrrmkefvstvmeqlkksktlfslmqyseefrihftfkefqn
npnprslvkpitqllgrthtatgirkvvrelfnitngarknafkilvvitdgekfgdplg
yedvipeadregviryvigvgdafrseksrqelntiaskpprdhvfqvnnfealktiqnq
lrek

SCOP Domain Coordinates for d1ido__:

Click to download the PDB-style file with coordinates for d1ido__.
(The format of our PDB-style files is described here.)

Timeline for d1ido__: