SCOPe 2.08: Domain d5wawl2: 5waw L:113-218

Lineage for d5wawl2 (5waw L:113-218)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5wawl2: 5waw L:113-218 [341385]
   Other proteins in same PDB: d5wawh_, d5wawl1
   automated match to d1t66c2
   complexed with gol, zn

Details for d5wawl2

PDB Entry: 5waw, 2.25 Å

PDB Description: fcabvance: increasing our knowledge of antibody structural space to enable faster and better decision-making in antibody drug discovery

PDB Compounds: (L:) Fab light chain

SCOPe Domain Sequences for d5wawl2:

Sequence; same for both SEQRES and ATOM records:

>d5wawl2 b.1.1.0 (L:113-218) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d5wawl2:

• d5wawl2 first appeared in SCOPe 2.06
  
• d5wawl2 appears in SCOPe 2.07