SCOPe 2.08: Domain d6b0wl1: 6b0w L:2-108

Lineage for d6b0wl1 (6b0w L:2-108)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)

8. Domain d6b0wl1: 6b0w L:2-108 [341382]
   Other proteins in same PDB: d6b0wl2
   automated match to d1lila1
   complexed with gol, ipa

Details for d6b0wl1

PDB Entry: 6b0w, 1.9 Å

PDB Description: crystal structure of the anti-circumsporozoite protein 1710 antibody

PDB Compounds: (L:) 1710 antibody, light chain

SCOPe Domain Sequences for d6b0wl1:

Sequence; same for both SEQRES and ATOM records:

>d6b0wl1 b.1.1.1 (L:2-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yeltqppsvsvspgqtasitcsgdklgdkyacwyqqkpgqspvvviyqdtkrpsgiperf
sgsnsgntatltisgtqamdeadyycqawdsstvvfgggtkltvlg

Timeline for d6b0wl1:

• d6b0wl1 first appeared in SCOPe 2.06
  
• d6b0wl1 appears in SCOPe 2.07