SCOP 1.73: Domain d1oaka_: 1oak A:

Lineage for d1oaka_ (1oak A:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.62: vWA-like [53299] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.62.1: vWA-like [53300] (5 families)

5. Family c.62.1.1: Integrin A (or I) domain [53301] (10 proteins)

6. Protein von Willebrand factor A1 domain, vWA1 [53306] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53307] (9 PDB entries)

8. Domain d1oaka_: 1oak A: [34138]
   Other proteins in same PDB: d1oakh1, d1oakh2, d1oakl1, d1oakl2

Details for d1oaka_

PDB Entry: 1oak, 2.2 Å

PDB Description: crystal structure of the von willebrand factor (vwf) a1 domain in complex with the function blocking nmc-4 fab

PDB Compounds: (A:) von willebrand factor

SCOP Domain Sequences for d1oaka_:

Sequence; same for both SEQRES and ATOM records:

>d1oaka_ c.62.1.1 (A:) von Willebrand factor A1 domain, vWA1 {Human (Homo sapiens) [TaxId: 9606]}
mycsrlldlvflldgssrlseaefevlkafvvdmmerlrisqkwvrvavveyhdgshayi
glkdrkrpselrriasqvkyagsqvastsevlkytlfqifskidrpeasrialllmasqe
pqrmsrnfvryvqglkkkkvivipvgigphanlkqirliekqapenkafvlssvdeleqq
rdeivsylcdlapeap

Timeline for d1oaka_:

• d1oaka_ first appeared (with stable ids) in SCOP 1.55
  
• d1oaka_ appears in SCOP 1.71
  
• d1oaka_ appears in SCOP 1.75
  
• d1oaka_ appears in the current release, SCOPe 2.08