Lineage for d1oaka_ (1oak A:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 318167Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 318168Superfamily c.62.1: vWA-like [53300] (2 families) (S)
  5. 318169Family c.62.1.1: Integrin A (or I) domain [53301] (8 proteins)
  6. 318223Protein von Willebrand factor A1 domain, vWA1 [53306] (1 species)
  7. 318224Species Human (Homo sapiens) [TaxId:9606] [53307] (6 PDB entries)
  8. 318227Domain d1oaka_: 1oak A: [34138]
    Other proteins in same PDB: d1oakh1, d1oakh2, d1oakl1, d1oakl2

Details for d1oaka_

PDB Entry: 1oak (more details), 2.2 Å

PDB Description: crystal structure of the von willebrand factor (vwf) a1 domain in complex with the function blocking nmc-4 fab
PDB Compounds: (A:)

SCOP Domain Sequences for d1oaka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oaka_ c.62.1.1 (A:) von Willebrand factor A1 domain, vWA1 {Human (Homo sapiens)}
mycsrlldlvflldgssrlseaefevlkafvvdmmerlrisqkwvrvavveyhdgshayi
glkdrkrpselrriasqvkyagsqvastsevlkytlfqifskidrpeasrialllmasqe
pqrmsrnfvryvqglkkkkvivipvgigphanlkqirliekqapenkafvlssvdeleqq
rdeivsylcdlapeap

SCOP Domain Coordinates for d1oaka_:

Click to download the PDB-style file with coordinates for d1oaka_.
(The format of our PDB-style files is described here.)

Timeline for d1oaka_: