Lineage for d5vmge_ (5vmg E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2775521Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2775522Protein Hemagglutinin [49824] (22 species)
    includes rudiment esterase domain
  7. 2775571Species Influenza A virus (a/new_york/1/18(h1n1)) [TaxId:88775] [346226] (2 PDB entries)
  8. 2775574Domain d5vmge_: 5vmg E: [341370]
    Other proteins in same PDB: d5vmgb_, d5vmgd_, d5vmgf_
    automated match to d3ztna_
    complexed with nag; mutant

Details for d5vmge_

PDB Entry: 5vmg (more details), 2.45 Å

PDB Description: influenza hemagglutinin h1 mutant dh1e in complex with 6'sln
PDB Compounds: (E:) hemagglutinin HA1

SCOPe Domain Sequences for d5vmge_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vmge_ b.19.1.2 (E:) Hemagglutinin {Influenza A virus (a/new_york/1/18(h1n1)) [TaxId: 88775]}
dticigyhannstdtvdtvleknvtvthsvnlledshngklcklkgiaplqlgkcniagw
llgnpecdllltasswsyivetsnsengtcypgdfidyeelreqlssvssfekfeifpkt
sswpnhettgvtaacsyagassfyrnllwltkkgssypklsksyvnnkgkevlvlwgvhh
pptgteqqslyqnadayvsvgsskynrrftpeiaarpkvrglasrmnyywtllepgdtit
featgnliapwyafalnrgsgsgiitsdapvhdcntkcqtphgainsslpfqnihpvtig
ecpkyvrstklrmatglrnip

SCOPe Domain Coordinates for d5vmge_:

Click to download the PDB-style file with coordinates for d5vmge_.
(The format of our PDB-style files is described here.)

Timeline for d5vmge_: