Lineage for d1auq__ (1auq -)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 588443Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 588444Superfamily c.62.1: vWA-like [53300] (4 families) (S)
  5. 588445Family c.62.1.1: Integrin A (or I) domain [53301] (10 proteins)
  6. 588531Protein von Willebrand factor A1 domain, vWA1 [53306] (1 species)
  7. 588532Species Human (Homo sapiens) [TaxId:9606] [53307] (8 PDB entries)
  8. 588535Domain d1auq__: 1auq - [34137]
    complexed with ium

Details for d1auq__

PDB Entry: 1auq (more details), 2.3 Å

PDB Description: a1 domain of von willebrand factor

SCOP Domain Sequences for d1auq__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1auq__ c.62.1.1 (-) von Willebrand factor A1 domain, vWA1 {Human (Homo sapiens)}
disepplhdfycsrlldlvflldgssrlseaefevlkafvvdmmerlrisqkwvrvavve
yhdgshayiglkdrkrpselrriasqvkyagsqvastsevlkytlfqifskidrpeasri
alllmasqepqrmsrnfvryvqglkkkkvivipvgigphanlkqirliekqapenkafvl
ssvdeleqqrdeivsylcdlapeapppt

SCOP Domain Coordinates for d1auq__:

Click to download the PDB-style file with coordinates for d1auq__.
(The format of our PDB-style files is described here.)

Timeline for d1auq__: