![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
![]() | Superfamily b.19.1: Viral protein domain [49818] (4 families) ![]() forms homotrimers |
![]() | Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
![]() | Protein Hemagglutinin [49824] (22 species) includes rudiment esterase domain |
![]() | Species Influenza A virus (a/new_york/1/18(h1n1)) [TaxId:88775] [346226] (2 PDB entries) |
![]() | Domain d5vmgc_: 5vmg C: [341369] Other proteins in same PDB: d5vmgb_, d5vmgd_, d5vmgf_ automated match to d3ztna_ complexed with nag; mutant |
PDB Entry: 5vmg (more details), 2.45 Å
SCOPe Domain Sequences for d5vmgc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vmgc_ b.19.1.2 (C:) Hemagglutinin {Influenza A virus (a/new_york/1/18(h1n1)) [TaxId: 88775]} dticigyhannstdtvdtvleknvtvthsvnlledshngklcklkgiaplqlgkcniagw llgnpecdllltasswsyivetsnsengtcypgdfidyeelreqlssvssfekfeifpkt sswpnhettgvtaacsyagassfyrnllwltkkgssypklsksyvnnkgkevlvlwgvhh pptgteqqslyqnadayvsvgsskynrrftpeiaarpkvrglasrmnyywtllepgdtit featgnliapwyafalnrgsgsgiitsdapvhdcntkcqtphgainsslpfqnihpvtig ecpkyvrstklrmatglrnip
Timeline for d5vmgc_: