SCOPe 2.08: Domain d5tuta1: 5tut A:1-147

Lineage for d5tuta1 (5tut A:1-147)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein automated matches [190124] (13 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186848] (52 PDB entries)

8. Domain d5tuta1: 5tut A:1-147 [341362]
   Other proteins in same PDB: d5tuta2, d5tutb_
   automated match to d2c2vb_

Details for d5tuta1

PDB Entry: 5tut, 2.6 Å

PDB Description: ubch5a-ub isopeptide conjugate

PDB Compounds: (A:) ubiquitin-conjugating enzyme e2 d1

SCOPe Domain Sequences for d5tuta1:

Sequence; same for both SEQRES and ATOM records:

>d5tuta1 d.20.1.1 (A:1-147) automated matches {Human (Homo sapiens) [TaxId: 9606]}
malkriqkelsdlqrdppahcsagpvgddlfhwqatimgppdsayqggvffltvhfptdy
pfkppkiafttkiyhpninsngsikldilrsqwspaltvskvllsicsllcdpnpddplv
pdiaqiyksdkekynrharewtqkyam

Timeline for d5tuta1:

• d5tuta1 first appeared in SCOPe 2.06
  
• d5tuta1 appears in SCOPe 2.07