Lineage for d5ob5a_ (5ob5 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928974Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 2928975Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 2928976Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)
  6. 2929002Protein Gro beta [54156] (1 species)
  7. 2929003Species Human (Homo sapiens) [TaxId:9606] [54157] (2 PDB entries)
  8. 2929004Domain d5ob5a_: 5ob5 A: [341360]
    Other proteins in same PDB: d5ob5h_, d5ob5l1, d5ob5l2
    automated match to d1qnka_
    complexed with gol, so4

Details for d5ob5a_

PDB Entry: 5ob5 (more details), 1.65 Å

PDB Description: fab complex with grobeta. abvance: increasing our knowledge of antibody structural space to enable faster and better decision-making in antibody drug discovery.
PDB Compounds: (A:) C-X-C motif chemokine 2

SCOPe Domain Sequences for d5ob5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ob5a_ d.9.1.1 (A:) Gro beta {Human (Homo sapiens) [TaxId: 9606]}
elrcqclqtlqgihlkniqsvkvkspgphcaqteviatlkngqkaclnpaspmvkkiiek
mlk

SCOPe Domain Coordinates for d5ob5a_:

Click to download the PDB-style file with coordinates for d5ob5a_.
(The format of our PDB-style files is described here.)

Timeline for d5ob5a_: