SCOPe 2.07: Domain d1fnsa1: 1fns A:508-702

Lineage for d1fnsa1 (1fns A:508-702)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.62: vWA-like [53299] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.62.1: vWA-like [53300] (6 families)

5. Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins)

6. Protein von Willebrand factor A1 domain, vWA1 [53306] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53307] (10 PDB entries)

8. Domain d1fnsa1: 1fns A:508-702 [34136]
   Other proteins in same PDB: d1fnsa2, d1fnsh1, d1fnsh2, d1fnsl1, d1fnsl2
   mutant

Details for d1fnsa1

PDB Entry: 1fns, 2 Å

PDB Description: crystal structure of the von willebrand factor (vwf) a1 domain i546v mutant in complex with the function blocking fab nmc4

PDB Compounds: (A:) von willebrand factor

SCOPe Domain Sequences for d1fnsa1:

Sequence; same for both SEQRES and ATOM records:

>d1fnsa1 c.62.1.1 (A:508-702) von Willebrand factor A1 domain, vWA1 {Human (Homo sapiens) [TaxId: 9606]}
ycsrlldlvflldgssrlseaefevlkafvvdmmerlrvsqkwvrvavveyhdgshayig
lkdrkrpselrriasqvkyagsqvastsevlkytlfqifskidrpeasrialllmasqep
qrmsrnfvryvqglkkkkvivipvgigphanlkqirliekqapenkafvlssvdeleqqr
deivsylcdlapeap

Timeline for d1fnsa1:

• d1fnsa1 first appeared (with stable ids) in SCOP 1.55, called d1fnsa_
  
• d1fnsa1 appears in SCOPe 2.06
  
• d1fnsa1 appears in the current release, SCOPe 2.08