Lineage for d1fnsa_ (1fns A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25985Fold c.62: Integrin A (or I) domain [53299] (1 superfamily)
  4. 25986Superfamily c.62.1: Integrin A (or I) domain [53300] (1 family) (S)
  5. 25987Family c.62.1.1: Integrin A (or I) domain [53301] (6 proteins)
  6. 26021Protein von Willebrand factor A1 domain [53306] (1 species)
  7. 26022Species Human (Homo sapiens) [TaxId:9606] [53307] (3 PDB entries)
  8. 26023Domain d1fnsa_: 1fns A: [34136]
    Other proteins in same PDB: d1fnsh1, d1fnsh2, d1fnsl1, d1fnsl2

Details for d1fnsa_

PDB Entry: 1fns (more details), 2 Å

PDB Description: crystal structure of the von willebrand factor (vwf) a1 domain i546v mutant in complex with the function blocking fab nmc4

SCOP Domain Sequences for d1fnsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fnsa_ c.62.1.1 (A:) von Willebrand factor A1 domain {Human (Homo sapiens)}
mycsrlldlvflldgssrlseaefevlkafvvdmmerlrvsqkwvrvavveyhdgshayi
glkdrkrpselrriasqvkyagsqvastsevlkytlfqifskidrpeasrialllmasqe
pqrmsrnfvryvqglkkkkvivipvgigphanlkqirliekqapenkafvlssvdeleqq
rdeivsylcdlapeap

SCOP Domain Coordinates for d1fnsa_:

Click to download the PDB-style file with coordinates for d1fnsa_.
(The format of our PDB-style files is described here.)

Timeline for d1fnsa_: