Lineage for d6b0sl1 (6b0s L:2-108)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2742602Domain d6b0sl1: 6b0s L:2-108 [341352]
    Other proteins in same PDB: d6b0sl2
    automated match to d1lila1
    complexed with gol, ipa

Details for d6b0sl1

PDB Entry: 6b0s (more details), 1.95 Å

PDB Description: crystal structure of circumsporozoite protein atsr domain in complex with 1710 antibody
PDB Compounds: (L:) 1710 antibody, light chain

SCOPe Domain Sequences for d6b0sl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6b0sl1 b.1.1.1 (L:2-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yeltqppsvsvspgqtasitcsgdklgdkyacwyqqkpgqspvvviyqdtkrpsgiperf
sgsnsgntatltisgtqamdeadyycqawdsstvvfgggtkltvlg

SCOPe Domain Coordinates for d6b0sl1:

Click to download the PDB-style file with coordinates for d6b0sl1.
(The format of our PDB-style files is described here.)

Timeline for d6b0sl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6b0sl2
View in 3D
Domains from other chains:
(mouse over for more information)
d6b0sh_