![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
![]() | Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
![]() | Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (8 proteins) the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology automatically mapped to Pfam PF02776 |
![]() | Protein Acetohydroxyacid synthase catalytic subunit [88733] (3 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [88734] (10 PDB entries) Uniprot P07342 84-687 |
![]() | Domain d6bd9b1: 6bd9 B:83-270 [341350] Other proteins in same PDB: d6bd9a2, d6bd9b2 automated match to d1n0ha2 complexed with fad, k, mg, oxy, po4, pyr, tpp |
PDB Entry: 6bd9 (more details), 1.98 Å
SCOPe Domain Sequences for d6bd9b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6bd9b1 c.36.1.5 (B:83-270) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} pdmdtsfvgltggqifnemmsrqnvdtvfgypggailpvydaihnsdkfnfvlpkheqga ghmaegyarasgkpgvvlvtsgpgatnvvtpmadafadgipmvvftgqvptsaigtdafq eadvvgisrsctkwnvmvksveelplrineafeiatsgrpgpvlvdlpkdvtaailrnpi ptkttlps
Timeline for d6bd9b1: