Lineage for d1ao3b_ (1ao3 B:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 72868Fold c.62: Integrin A (or I) domain [53299] (1 superfamily)
  4. 72869Superfamily c.62.1: Integrin A (or I) domain [53300] (1 family) (S)
  5. 72870Family c.62.1.1: Integrin A (or I) domain [53301] (6 proteins)
  6. 72910Protein von Willebrand factor A3 domain [53304] (1 species)
  7. 72911Species Human (Homo sapiens) [TaxId:9606] [53305] (3 PDB entries)
  8. 72915Domain d1ao3b_: 1ao3 B: [34135]

Details for d1ao3b_

PDB Entry: 1ao3 (more details), 2.2 Å

PDB Description: a3 domain of von willebrand factor

SCOP Domain Sequences for d1ao3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ao3b_ c.62.1.1 (B:) von Willebrand factor A3 domain {Human (Homo sapiens)}
csqpldvillldgsssfpasyfdemksfakafiskanigprltqvsvlqygsittidvpw
nvvpekahllslvdvmqreggpsqigdalgfavryltsemhgarpgaskavvilvtdvsv
dsvdaaadaarsnrvtvfpigigdrydaaqlrilagpagdsnvvklqriedlptmvtlgn
sflhklc

SCOP Domain Coordinates for d1ao3b_:

Click to download the PDB-style file with coordinates for d1ao3b_.
(The format of our PDB-style files is described here.)

Timeline for d1ao3b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ao3a_