SCOPe 2.06: Domain d3raua_: 3rau A:

Lineage for d3raua_ (3rau A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.8: TPR-like [48452] (9 families)

5. Family a.118.8.0: automated matches [191581] (1 protein)
   not a true family

6. Protein automated matches [191037] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255451] (7 PDB entries)

8. Domain d3raua_: 3rau A: [341347]
   automated match to d5crua_
   complexed with act, edo, gol

Details for d3raua_

PDB Entry: 3rau, 1.95 Å

PDB Description: crystal structure of the hd-ptp bro1 domain

PDB Compounds: (A:) tyrosine-protein phosphatase non-receptor type 23

SCOPe Domain Sequences for d3raua_:

Sequence; same for both SEQRES and ATOM records:

>d3raua_ a.118.8.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vprmpmiwldlkeagdfhfqpavkkfvlknygenpeayneelkklellrqnavrvprdfe
gcsvlrkylgqlhylqsrvpmgsgqeaavpvtwteifsgksvahedikyeqacilynlga
lhsmlgamdkrvseegmkvscthfqcaagafaylrehfpqaysvdmsrqiltlnvnlmlg
qaqeclleksmldnrksflvarisaqvvdyykeacralenpdtasllgriqkdwkklvqm
kiyyfaavahlhmgkqaeeqqkfgervayfqsaldklneaiklakgqpdtvqdalrftmd
viggkynsakkdndfiyheavpaldtlqpvkgaplvkplpvnptdpavtgpdifaklv

Timeline for d3raua_:

• d3raua_ is new in SCOPe 2.06-stable
  
• d3raua_ appears in SCOPe 2.07
  
• d3raua_ appears in the current release, SCOPe 2.08