Lineage for d5ovwh_ (5ovw H:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2023921Protein automated matches [190119] (22 species)
    not a true protein
  7. 2024425Species Llama (Lama glama) [TaxId:9844] [187485] (138 PDB entries)
  8. 2024674Domain d5ovwh_: 5ovw H: [341341]
    Other proteins in same PDB: d5ovwa_, d5ovwb_, d5ovwc_, d5ovwd_, d5ovwe_, d5ovwf_
    automated match to d4grwf_
    complexed with gol

Details for d5ovwh_

PDB Entry: 5ovw (more details), 2.65 Å

PDB Description: nanobody-bound btuf, the vitamin b12 binding protein in escherichia coli
PDB Compounds: (H:) Nanobody

SCOPe Domain Sequences for d5ovwh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ovwh_ b.1.1.1 (H:) automated matches {Llama (Lama glama) [TaxId: 9844]}
mqlvesggglvqpggslrlscaapestlddyaigwfrqapgkeregvscigssgdstnya
dsvkgrftvsrdnakntvylqmndlrpedtavyycaaahrifggclvihssgyvswgqgt
pvtvss

SCOPe Domain Coordinates for d5ovwh_:

Click to download the PDB-style file with coordinates for d5ovwh_.
(The format of our PDB-style files is described here.)

Timeline for d5ovwh_: