![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.62: vWA-like [53299] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
![]() | Superfamily c.62.1: vWA-like [53300] (5 families) ![]() |
![]() | Family c.62.1.1: Integrin A (or I) domain [53301] (10 proteins) |
![]() | Protein von Willebrand factor A3 domain, vWA3 [53304] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [53305] (4 PDB entries) |
![]() | Domain d1ao3a_: 1ao3 A: [34134] |
PDB Entry: 1ao3 (more details), 2.2 Å
SCOP Domain Sequences for d1ao3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ao3a_ c.62.1.1 (A:) von Willebrand factor A3 domain, vWA3 {Human (Homo sapiens) [TaxId: 9606]} csqpldvillldgsssfpasyfdemksfakafiskanigprltqvsvlqygsittidvpw nvvpekahllslvdvmqreggpsqigdalgfavryltsemhgarpgaskavvilvtdvsv dsvdaaadaarsnrvtvfpigigdrydaaqlrilagpagdsnvvklqriedlptmvtlgn sflhklc
Timeline for d1ao3a_: